PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_36942.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 147aa    MW: 16960.5 Da    PI: 10.055
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_36942.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.33.6e-5061331128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                   lppG+rFhPtd el  +yLk+k+ gkkl++ ++++evdiyk+ Pw+Lp k ++ +++ +wyfF++r +ky+ g r+nr+t+ gyWkatgkd++v+  
  MLOC_36942.2   6 LPPGYRFHPTDVELTLYYLKRKLLGKKLHC-NTVAEVDIYKFPPWELPaKsSMPTGDLQWYFFCTRGRKYSVGYRTNRSTEGGYWKATGKDRQVVY- 100
                   79****************************.88***************4246666888**************************************. PP

           NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                   ++++vg+k+tLvf+ g+apkg++tdWvm eyrl
  MLOC_36942.2 101 ENRTVGMKRTLVFHAGKAPKGTRTDWVMYEYRL 133
                   9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.01E-552138IPR003441NAC domain
PROSITE profilePS5100550.7626147IPR003441NAC domain
PfamPF023653.5E-267133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MDMPPLPPGY RFHPTDVELT LYYLKRKLLG KKLHCNTVAE VDIYKFPPWE LPAKSSMPTG  60
DLQWYFFCTR GRKYSVGYRT NRSTEGGYWK ATGKDRQVVY ENRTVGMKRT LVFHAGKAPK  120
GTRTDWVMYE YRLAQGEIPD AGARLAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-47613315140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00583DAPTransfer from AT5G64060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3707770.0AK370777.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2116L22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003581627.12e-73PREDICTED: NAC domain-containing protein 102-like
SwissprotA4VCM03e-57NAC45_ARATH; NAC domain-containing protein 45
TrEMBLM0VST01e-106M0VST0_HORVD; Uncharacterized protein
TrEMBLM0VST11e-107M0VST1_HORVD; Uncharacterized protein
STRINGMLOC_36942.11e-106(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03200.13e-49NAC domain containing protein 45